DrugLib.com — Drug Information Portal

Rx drug information, pharmaceutical research, clinical trials, news, and more

Active ingredient: Sargramostim - Chemisty and Biological Activity

Chemisty and Biological Activity

Chemical Formula

C639H1006N168O196S8

Chemical Name

Human granulocyte macrophage colony stimulating factor

Chemical Structure

APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQ EPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQI ITFESFKENLKDFLLVIPFDCWEPVQE

Molecular Weight

14434.5

Physical State

Liquid

Melting Point

Not Available

Water Solubility

Not Available

Isoelectric Point

5.05

Organisms Affected

Not Available

Phase 1 Metabolising Enzyme (1-st Step of Metabolism)

Not Available

Primary Drug Target
NameGranulocyte-macrophage colony stimulating factor receptor (GM-CSF-R-alpha or CSF2R)
Gene Name(CSF2RAX
SynonymsGranulocyte-macrophage colony-stimulating factor receptor alpha chain precursor; GM-CSF-R-alpha; GMR; CDw116; CD116 antigen
Specific FunctionLow affinity receptor for granulocyte-macrophage colony- stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells

-- advertisement -- The American Red Cross
 
Home | About Us | Contact Us | Site usage policy | Privacy policy

All Rights reserved - Copyright DrugLib.com, 2006-2017